ARV1 antibody

Catalog No. ABIN635026

This Rabbit Polyclonal antibody specifically detects ARV1 in WB. It exhibits reactivity toward Human.

Quick Overview for ARV1 antibody (ABIN635026)

Target: ARV1 (ARV1 Homolog (ARV1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARV1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARV1 Antibody

Purification: Affinity purified

Immunogen: ARV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARV1 Blocking Peptide, (ABIN5612174), is also available for use as a blocking control in assays to test for specificity of this ARV1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARV1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARV1

Target: ARV1 (ARV1 Homolog (ARV1))

Alternative Name: ARV1

Background: ARV1 may act as a mediator of sterol homeostasis.

Molecular Weight: 31 kDa (MW of target protein)