MAVS antibody (C-Term)

Catalog No. ABIN635036

Product Details anti-MAVS Antibody

Target: MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAVS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VISA antibody was raised against the C terminal of VISA

Purification: Affinity purified

Immunogen: VISA antibody was raised using the C terminal of VISA corresponding to a region with amino acids VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VISA Blocking Peptide, catalog no. 33R-9412, is also available for use as a blocking control in assays to test for specificity of this VISA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VISA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAVS

Target: MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))

Alternative Name: VISA (MAVS Products)

Synonyms: CARDIF antibody, IPS-1 antibody, IPS1 antibody, VISA antibody, D430028G21Rik antibody, Visa antibody, cardif antibody, wu:fj20d04 antibody, zgc:158392 antibody, mitochondrial antiviral signaling protein antibody, MAVS antibody, Mavs antibody, mavs antibody

Background: Double-stranded RNA viruses are recognised in a cell type-dependent manner by the transmembrane receptor TLR3 or by the cytoplasmic RNA helicases MDA5 and RIGI (ROBO3). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK) and IKKB (IKBKB), which activate NFKB, or TBK1 and IKKE (IKBKE), which activate IRF3. Activated IRF3 and NFKB induce transcription of IFNB (IFNB1). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1). For RIGI, the intermediary protein is mitochondria-bound VISA.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Inositol Metabolic Process, Hepatitis C