SLC25A38 antibody (Solute Carrier Family 25, Member 38) (Middle Region)

Details for Product anti-SLC25A38 Antibody No. ABIN635042
Antigen
Epitope
Middle Region
4
3
2
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
33
9
6
4
3
2
2
2
1
1
1
1
Host
Rabbit
26
7
Clonality
Polyclonal
Conjugate
This SLC25A38 antibody is un-conjugated
4
3
2
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
18
17
9
2
1
1
Options
Immunogen SLC25 A38 antibody was raised using the middle region of SLC25 38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR
Specificity SLC25 A38 antibody was raised against the middle region of SLC25 38
Purification Affinity purified
Antigen
Alternative Name SLC25A38 (SLC25A38 Antibody Abstract)
Background SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
Molecular Weight 33 kDa (MW of target protein)
Application Notes WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SLC25A38 Blocking Peptide, catalog no. 33R-9563, is also available for use as a blocking control in assays to test for specificity of this SLC25A38 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 38 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Solute Carrier Family 25, Member 38 (SLC25A38) (Middle Region) antibody (ABIN635042) SLC25A38 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml t...
Image no. 2 for anti-Solute Carrier Family 25, Member 38 (SLC25A38) (Middle Region) antibody (ABIN635042) SLC25A38 antibody used at 0.25 ug/ml to detect target protein.