GPRC5A antibody (C-Term)

Catalog No. ABIN635045

The Rabbit Polyclonal anti-GPRC5A antibody is suitable to detect GPRC5A in samples from Human and Mouse. It has been validated for WB.

Quick Overview for GPRC5A antibody (C-Term) (ABIN635045)

Target: GPRC5A (G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPRC5A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GPRC5A Antibody

Binding Specificity: C-Term

Specificity: GPCR5 A antibody was raised against the C terminal Of Gpcr5

Purification: Affinity purified

Immunogen: GPCR5 A antibody was raised using the C terminal Of Gpcr5 corresponding to a region with amino acids SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPCR5A Blocking Peptide, (ABIN5613828), is also available for use as a blocking control in assays to test for specificity of this GPCR5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPCR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPRC5A

Target: GPRC5A (G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A))

Alternative Name: GPCR5A

Background: GPCR5A is a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. Its gene may play a role in embryonic development and epithelial cell differentiation.

Molecular Weight: 39 kDa (MW of target protein)