SLC25A28 antibody (Middle Region)

Catalog No. ABIN635048

The Rabbit Polyclonal anti-SLC25A28 antibody has been validated for WB. It is suitable to detect SLC25A28 in samples from Human, Mouse and Rat.

Quick Overview for SLC25A28 antibody (Middle Region) (ABIN635048)

Target: SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A28 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A28 Antibody

Binding Specificity: Middle Region

Specificity: SLC25 A28 antibody was raised against the middle region of SLC25 28

Purification: Affinity purified

Immunogen: SLC25 A28 antibody was raised using the middle region of SLC25 28 corresponding to a region with amino acids VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A28 Blocking Peptide, (ABIN5616219), is also available for use as a blocking control in assays to test for specificity of this SLC25A28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A28

Target: SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))

Alternative Name: SLC25A28

Background: SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis