MFRP antibody (Middle Region)

Catalog No. ABIN635049

Product Details anti-MFRP Antibody

Target: MFRP (Membrane Frizzled-Related Protein (MFRP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFRP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MFRP antibody was raised against the middle region of MFRP

Purification: Affinity purified

Immunogen: MFRP antibody was raised using the middle region of MFRP corresponding to a region with amino acids HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFRP Blocking Peptide, catalog no. 33R-3691, is also available for use as a blocking control in assays to test for specificity of this MFRP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFRP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFRP

Target: MFRP (Membrane Frizzled-Related Protein (MFRP))

Alternative Name: MFRP (MFRP Products)

Synonyms: MFRP antibody, MCOP5 antibody, NNO2 antibody, RD6 antibody, rd6 antibody, C1q and TNF related 5 antibody, membrane frizzled-related protein antibody, C1QTNF5 antibody, MFRP antibody, Mfrp antibody

Background: MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic mRNA, which also encodes C1q and tumor necrosis factor related protein 5.

Molecular Weight: 62 kDa (MW of target protein)