Monoamine Oxidase B antibody (N-Term)

Catalog No. ABIN635050

This Rabbit Polyclonal antibody specifically detects Monoamine Oxidase B in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Monoamine Oxidase B antibody (N-Term) (ABIN635050)

Target: Monoamine Oxidase B (MAOB)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Monoamine Oxidase B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Monoamine Oxidase B Antibody

Binding Specificity: N-Term

Specificity: MAOB antibody was raised against the N terminal of MAOB

Purification: Affinity purified

Immunogen: MAOB antibody was raised using the N terminal of MAOB corresponding to a region with amino acids RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAOB Blocking Peptide, (ABIN5614645), is also available for use as a blocking control in assays to test for specificity of this MAOB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Monoamine Oxidase B

Target: Monoamine Oxidase B (MAOB)

Alternative Name: MAOB

Background: MAOB belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.

Molecular Weight: 59 kDa (MW of target protein)