Cell Cycle Exit and Neuronal Differentiation 1 (CEND1) (N-Term) antibody

Details for Product No. ABIN635055
Antigen
Epitope
N-Term
5
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
29
22
15
2
1
1
1
Host
Rabbit
28
1
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
2
Application
Western Blotting (WB)
14
13
5
3
2
1
1
Options
Immunogen CEND1 antibody was raised using the N terminal of CEND1 corresponding to a region with amino acids MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ
Specificity CEND1 antibody was raised against the N terminal of CEND1
Purification Affinity purified
Antigen
Alternative Name CEND1 (CEND1 Antibody Abstract)
Background CEND1 is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.
Molecular Weight 15 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CEND1 Blocking Peptide, catalog no. 33R-5964, is also available for use as a blocking control in assays to test for specificity of this CEND1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEND1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Cell Cycle Exit and Neuronal Differentiation 1 (CEND1) (N-Term) antibody (ABIN635055) CEND1 antibody used at 1 ug/ml to detect target protein.