NHEDC2 antibody (C-Term)

Catalog No. ABIN635063

The Rabbit Polyclonal anti-NHEDC2 antibody has been validated for WB. It is suitable to detect NHEDC2 in samples from Human, Mouse and Rat.

Quick Overview for NHEDC2 antibody (C-Term) (ABIN635063)

Target: NHEDC2 (Na+/H+ Exchanger Domain Containing 2 (NHEDC2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NHEDC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NHEDC2 Antibody

Binding Specificity: C-Term

Specificity: NHEDC2 antibody was raised against the C terminal of NHEDC2

Purification: Affinity purified

Immunogen: NHEDC2 antibody was raised using the C terminal of NHEDC2 corresponding to a region with amino acids IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NHEDC2 Blocking Peptide, (ABIN939343), is also available for use as a blocking control in assays to test for specificity of this NHEDC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHEDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NHEDC2

Target: NHEDC2 (Na+/H+ Exchanger Domain Containing 2 (NHEDC2))

Alternative Name: NHEDC2

Background: Sodium hydrogen antiporters, such as NHEDC2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Proton Transport