Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

SLC25A32 antibody (Solute Carrier Family 25, Member 32) (N-Term) Primary Antibody

SLC25A32 Reactivity: Human, Mouse, Rat, Dog WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635067
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    SLC25A32
    Binding Specificity
    N-Term
    • 4
    • 2
    • 1
    • 1
    • 1
    Reactivity
    Human, Mouse, Rat, Dog
    • 10
    • 7
    • 6
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Conjugate
    This SLC25A32 antibody is un-conjugated
    • 7
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 7
    • 5
    Specificity
    SLC25 A32 antibody was raised against the N terminal of SLC25 32
    Purification
    Affinity purified
    Immunogen
    SLC25 A32 antibody was raised using the N terminal of SLC25 32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT
  • Application Notes
    WB: 0.25 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    SLC25A32 Blocking Peptide, catalog no. 33R-9795, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    SLC25A32
    Alternative Name
    SLC25A32 (SLC25A32 Antibody Abstract)
    Synonyms
    fi40c12, mftc, wu:fi40c12, zgc:55610, zgc:110786, RGD1565789, MFT, MFTC, 2610043O12Rik, Mftc, solute carrier family 25 (mitochondrial folate carrier), member 32a, solute carrier family 25 (mitochondrial folate carrier), member 32b, NAD transporter, mitochondrial folate transporter/carrier, solute carrier family 25 member 32, solute carrier family 25 (mitochondrial folate carrier), member 32 L homeolog, solute carrier family 25, member 32, slc25a32a, slc25a32b, SJAG_04328, PAAG_07673, PAAG_03661, MCYG_01228, MGYG_01778, SLC25A32, Slc25a32, slc25a32.L
    Background
    SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.
    Molecular Weight
    35 kDa (MW of target protein)
    Pathways
    Dicarboxylic Acid Transport
You are here:
help Support