LINGO4 antibody (Middle Region)

Catalog No. ABIN635071

This Rabbit Polyclonal antibody specifically detects LINGO4 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LINGO4 antibody (Middle Region) (ABIN635071)

Target: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LINGO4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LINGO4 Antibody

Binding Specificity: Middle Region

Specificity: LINGO4 antibody was raised against the middle region of LINGO4

Purification: Affinity purified

Immunogen: LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LINGO4 Blocking Peptide, (ABIN5614462), is also available for use as a blocking control in assays to test for specificity of this LINGO4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LINGO4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LINGO4

Target: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Alternative Name: LINGO4

Background: The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 64 kDa (MW of target protein)