SLC25A11 antibody

Catalog No. ABIN635079

This anti-SLC25A11 antibody is a Rabbit Polyclonal antibody detecting SLC25A11 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SLC25A11 antibody (ABIN635079)

Target: SLC25A11 (Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A11 Antibody

Purification: Affinity purified

Immunogen: SLC25 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A11 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC25A11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A11

Target: SLC25A11 (Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11))

Alternative Name: SLC25A11

Background: SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport