Slc25a1 antibody

Catalog No. ABIN635081

The Rabbit Polyclonal anti-Slc25a1 antibody has been validated for WB. It is suitable to detect Slc25a1 in samples from Human.

Quick Overview for Slc25a1 antibody (ABIN635081)

Target: Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Slc25a1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Slc25a1 Antibody

Purification: Affinity purified

Immunogen: SLC25 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A1 Blocking Peptide, (ABIN5616209), is also available for use as a blocking control in assays to test for specificity of this SLC25A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Slc25a1

Target: Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))

Alternative Name: SLC25A1

Background: The mitochondrial tricarboxylate transporter (also called citrate transport protein, or CTP) is responsible for the movement of citrate across the mitochondrial inner membrane.

Molecular Weight: 34 kDa (MW of target protein)