SLC25A34 antibody (Middle Region)

Catalog No. ABIN635088

This anti-SLC25A34 antibody is a Rabbit Polyclonal antibody detecting SLC25A34 in WB. Suitable for Human and Mouse.

Quick Overview for SLC25A34 antibody (Middle Region) (ABIN635088)

Target: SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A34 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A34 Antibody

Binding Specificity: Middle Region

Specificity: SLC25 A34 antibody was raised against the middle region of SLC25 34

Purification: Affinity purified

Immunogen: SLC25 A34 antibody was raised using the middle region of SLC25 34 corresponding to a region with amino acids TDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A34 Blocking Peptide, (ABIN5616222), is also available for use as a blocking control in assays to test for specificity of this SLC25A34 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A34

Target: SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))

Alternative Name: SLC25A34

Background: SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins.

Molecular Weight: 32 kDa (MW of target protein)