COX18 antibody

Catalog No. ABIN635096

The Rabbit Polyclonal anti-COX18 antibody has been validated for WB. It is suitable to detect COX18 in samples from Human.

Quick Overview for COX18 antibody (ABIN635096)

Target: COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COX18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-COX18 Antibody

Purification: Affinity purified

Immunogen: COX18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COX18 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this COX18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COX18

Target: COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))

Alternative Name: COX18

Background: COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.

Molecular Weight: 37 kDa (MW of target protein)