MFRP antibody (N-Term)

Catalog No. ABIN635098

This Rabbit Polyclonal antibody specifically detects MFRP in WB. It exhibits reactivity toward Human.

Quick Overview for MFRP antibody (N-Term) (ABIN635098)

Target: MFRP (Membrane Frizzled-Related Protein (MFRP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFRP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MFRP Antibody

Binding Specificity: N-Term

Specificity: MFRP antibody was raised against the N terminal of MFRP

Purification: Affinity purified

Immunogen: MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFRP Blocking Peptide, (ABIN5614740), is also available for use as a blocking control in assays to test for specificity of this MFRP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFRP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFRP

Target: MFRP (Membrane Frizzled-Related Protein (MFRP))

Alternative Name: MFRP

Background: MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen.

Molecular Weight: 62 kDa (MW of target protein)