TRPM2 antibody (Transient Receptor Potential Cation Channel, Subfamily M, Member 2) (N-Term)

Details for Product anti-TRPM2 Antibody No. ABIN635099
Antigen
Epitope
N-Term
5
4
3
2
2
2
2
2
2
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
46
20
19
2
1
1
1
Host
Rabbit
63
2
1
Clonality
Polyclonal
Conjugate
This TRPM2 antibody is un-conjugated
4
3
2
2
2
1
1
1
1
1
1
1
Application
Western Blotting (WB)
47
38
19
12
8
6
5
2
1
1
1
1
1
Options
Immunogen TRPM2 antibody was raised using the N terminal of TRPM2 corresponding to a region with amino acids VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
Specificity TRPM2 antibody was raised against the N terminal of TRPM2
Purification Affinity purified
Antigen
Alternative Name TRPM2 (TRPM2 Antibody Abstract)
Background The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Molecular Weight 171 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TRPM2 Blocking Peptide, catalog no. 33R-9418, is also available for use as a blocking control in assays to test for specificity of this TRPM2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2) (N-Term) antibody (ABIN635099) TRPM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Mag...
Image no. 2 for anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2) (N-Term) antibody (ABIN635099) Western Blot showing TRPM2 antibody used at a concentration of 1 ug/ml against Fetal ...