MS4A14 antibody (Middle Region)

Catalog No. ABIN635103

This anti-MS4A14 antibody is a Rabbit Polyclonal antibody detecting MS4A14 in WB. Suitable for Human.

Quick Overview for MS4A14 antibody (Middle Region) (ABIN635103)

Target: MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MS4A14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MS4A14 Antibody

Binding Specificity: Middle Region

Specificity: NYD-SP21 antibody was raised against the middle region of Nyd-Sp21

Purification: Affinity purified

Immunogen: NYD-SP21 antibody was raised using the middle region of Nyd-Sp21 corresponding to a region with amino acids QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NYD-SP21 Blocking Peptide, (ABIN5615096), is also available for use as a blocking control in assays to test for specificity of this NYD-SP21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NYD-SP21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MS4A14

Target: MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))

Alternative Name: NYD-SP21

Background: NYD-SP21 may be involved in signal transduction as a component of a multimeric receptor complex.

Molecular Weight: 76 kDa (MW of target protein)