OR11H12 antibody (N-Term)
-
- Target See all OR11H12 Antibodies
- OR11H12 (Olfactory Receptor, Family 11, Subfamily H, Member 12 (OR11H12))
- Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OR11H12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OR11 H12 antibody was raised against the N terminal of OR11 12
- Purification
- Affinity purified
- Immunogen
- OR11 H12 antibody was raised using the N terminal of OR11 12 corresponding to a region with amino acids CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OR11H12 Blocking Peptide, catalog no. 33R-1768, is also available for use as a blocking control in assays to test for specificity of this OR11H12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OR11H12 (Olfactory Receptor, Family 11, Subfamily H, Member 12 (OR11H12))
- Alternative Name
- OR11H12 (OR11H12 Products)
- Background
- Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.
- Molecular Weight
- 36 kDa (MW of target protein)
-