DIRC2 antibody (Middle Region)
-
- Target See all DIRC2 Antibodies
- DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DIRC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DIRC2 antibody was raised against the middle region of DIRC2
- Purification
- Affinity purified
- Immunogen
- DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ
- Top Product
- Discover our top product DIRC2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DIRC2 Blocking Peptide, catalog no. 33R-1018, is also available for use as a blocking control in assays to test for specificity of this DIRC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))
- Alternative Name
- DIRC2 (DIRC2 Products)
- Synonyms
- MGC80843 antibody, zgc:92095 antibody, rcc4 antibody, MGC69320 antibody, RCC4 antibody, disrupted in renal carcinoma 2 antibody, disrupted in renal carcinoma 2 L homeolog antibody, disrupted in renal carcinoma 2 (human) antibody, DIRC2 antibody, dirc2.L antibody, dirc2 antibody, Dirc2 antibody
- Background
- DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.
- Molecular Weight
- 52 kDa (MW of target protein)
-