SLC6A5 antibody

Catalog No. ABIN635139

This anti-SLC6A5 antibody is a Rabbit Polyclonal antibody detecting SLC6A5 in WB. Suitable for Human.

Quick Overview for SLC6A5 antibody (ABIN635139)

Target: SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC6A5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC6A5 Antibody

Purification: Affinity purified

Immunogen: SLC6 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC6A5 Blocking Peptide, (ABIN940454), is also available for use as a blocking control in assays to test for specificity of this SLC6A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC6A5

Target: SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))

Alternative Name: SLC6A5

Background: This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission.

Molecular Weight: 87 kDa (MW of target protein)