DNAJC10 antibody

Catalog No. ABIN635149

This Rabbit Polyclonal antibody specifically detects DNAJC10 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for DNAJC10 antibody (ABIN635149)

Target: DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJC10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNAJC10 Antibody

Purification: Affinity purified

Immunogen: DNAJC10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJC10 Blocking Peptide, (ABIN937327), is also available for use as a blocking control in assays to test for specificity of this DNAJC10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJC10

Target: DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))

Alternative Name: DNAJC10

Background: This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.

Molecular Weight: 91 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis