DNAJC10 antibody
-
- Target See all DNAJC10 Antibodies
- DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DNAJC10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DNAJC10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY
- Top Product
- Discover our top product DNAJC10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DNAJC10 Blocking Peptide, catalog no. 33R-1941, is also available for use as a blocking control in assays to test for specificity of this DNAJC10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))
- Alternative Name
- DNAJC10 (DNAJC10 Products)
- Background
- This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
- Molecular Weight
- 91 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-