LRRC4C antibody (N-Term)

Catalog No. ABIN635150

The Rabbit Polyclonal anti-LRRC4C antibody has been validated for WB. It is suitable to detect LRRC4C in samples from Human, Mouse and Rat.

Quick Overview for LRRC4C antibody (N-Term) (ABIN635150)

Target: LRRC4C (Leucine Rich Repeat Containing 4C (LRRC4C))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC4C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRC4C Antibody

Binding Specificity: N-Term

Specificity: LRRC4 C antibody was raised against the N terminal of LRRC4

Purification: Affinity purified

Immunogen: LRRC4 C antibody was raised using the N terminal of LRRC4 corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC4C Blocking Peptide, (ABIN5614576), is also available for use as a blocking control in assays to test for specificity of this LRRC4C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC4C

Target: LRRC4C (Leucine Rich Repeat Containing 4C (LRRC4C))

Alternative Name: LRRC4C

Background: NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: Synaptic Membrane