PANX1 antibody (Middle Region)

Catalog No. ABIN635152

This Rabbit Polyclonal antibody specifically detects PANX1 in WB and IHC. It exhibits reactivity toward Mammalian.

Quick Overview for PANX1 antibody (Middle Region) (ABIN635152)

Target: PANX1 (Pannexin 1 (PANX1))

Reactivity: Mammalian

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PANX1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PANX1 Antibody

Binding Specificity: Middle Region

Specificity: Pannexin 1 antibody was raised against the middle region of PANX1

Cross-Reactivity: Human

Purification: Affinity purified

Immunogen: Pannexin 1 antibody was raised using the middle region of PANX1 corresponding to a region with amino acids LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Pannexin 1 Blocking Peptide, (ABIN940391), is also available for use as a blocking control in assays to test for specificity of this Pannexin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PANX1

Target: PANX1 (Pannexin 1 (PANX1))

Alternative Name: Pannexin 1

Background: PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Molecular Weight: 47 kDa (MW of target protein)