IgA antibody (Middle Region)

Catalog No. ABIN635180

The Rabbit Polyclonal anti-IgA antibody has been validated for WB. It is suitable to detect IgA in samples from Human.

Quick Overview for IgA antibody (Middle Region) (ABIN635180)

Target: IgA

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IgA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IgA Antibody

Binding Specificity: Middle Region

Specificity: PIGA antibody was raised against the middle region of PIGA

Purification: Affinity purified

Immunogen: PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGA Blocking Peptide, (ABIN5615364), is also available for use as a blocking control in assays to test for specificity of this PIGA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IgA

Target: IgA

Target Type: Antibody

Background: PIGA is a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene.

Molecular Weight: 19 kDa (MW of target protein)