Calsyntenin 3 (CLSTN3) (N-Term) antibody

Details for Product No. ABIN635191
Antigen
Epitope
N-Term
1
1
Reactivity
Human
3
2
2
2
2
2
2
1
1
1
1
Host
Rabbit
3
Clonality
Polyclonal
Application
Western Blotting (WB)
3
1
1
Options
Immunogen Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
Specificity Calsyntenin 3 antibody was raised against the N terminal of CLSTN3
Purification Affinity purified
Antigen
Alternative Name Calsyntenin 3 (CLSTN3 Antibody Abstract)
Background CLSTN3 may modulate calcium-mediated postsynaptic signals. Complex formation with APBA2 and APP,CLSTN3 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.
Molecular Weight 106 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Calsyntenin 3 Blocking Peptide, catalog no. 33R-7585, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 3 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Calsyntenin 3 (CLSTN3) (N-Term) antibody (ABIN635191) Calsyntenin 3 antibody used at 1 ug/ml to detect target protein.