DLG2 antibody

Catalog No. ABIN635193

This anti-DLG2 antibody is a Rabbit Polyclonal antibody detecting DLG2 in WB. Suitable for Human, Rat and Mouse.

Quick Overview for DLG2 antibody (ABIN635193)

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLG2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLG2 Antibody

Purification: Affinity purified

Immunogen: DLG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLG2 Blocking Peptide, (ABIN5613216), is also available for use as a blocking control in assays to test for specificity of this DLG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLG2

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Alternative Name: DLG2

Background: DLG2 is a member of the membrane-associated guanylate kinase (MAGUK) family. The protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins.

Molecular Weight: 97 kDa (MW of target protein)