LPPR5 antibody (N-Term)

Catalog No. ABIN635195

The Rabbit Polyclonal anti-LPPR5 antibody has been validated for WB. It is suitable to detect LPPR5 in samples from Human, Mouse and Rat.

Quick Overview for LPPR5 antibody (N-Term) (ABIN635195)

Target: LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LPPR5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LPPR5 Antibody

Binding Specificity: N-Term

Specificity: PAP2 D antibody was raised against the N terminal of PAP2

Purification: Affinity purified

Immunogen: PAP2 D antibody was raised using the N terminal of PAP2 corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAP2D Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this PAP2D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LPPR5

Target: LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))

Alternative Name: PAP2D

Background: PAP2D is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Molecular Weight: 35 kDa (MW of target protein)