IL18R1 antibody (N-Term)
-
- Target See all IL18R1 Antibodies
- IL18R1 (Interleukin 18 Receptor 1 (IL18R1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL18R1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IL18 R1 antibody was raised against the N terminal of IL18 1
- Purification
- Affinity purified
- Immunogen
- IL18 R1 antibody was raised using the N terminal of IL18 1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE
- Top Product
- Discover our top product IL18R1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IL18R1 Blocking Peptide, catalog no. 33R-7090, is also available for use as a blocking control in assays to test for specificity of this IL18R1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL18R1 (Interleukin 18 Receptor 1 (IL18R1))
- Alternative Name
- IL18R1 (IL18R1 Products)
- Synonyms
- CD218a antibody, CDw218a antibody, IL-1Rrp antibody, IL18RA antibody, IL1RRP antibody, IL-1R9 antibody, IL1R9 antibody, IL1RAPL-2 antibody, TIGIRR-1 antibody, Il18ralpha antibody, Il1rrp antibody, IL-18Ra antibody, IL18R1 antibody, interleukin 18 receptor 1 antibody, interleukin 1 receptor accessory protein like 2 antibody, IL18R1 antibody, IL1RAPL2 antibody, Il18r1 antibody
- Background
- The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction.
- Molecular Weight
- 60 kDa (MW of target protein)
-