RHBDF1 antibody

Catalog No. ABIN635205

This anti-RHBDF1 antibody is a Rabbit Polyclonal antibody detecting RHBDF1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RHBDF1 antibody (ABIN635205)

Target: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHBDF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RHBDF1 Antibody

Purification: Affinity purified

Immunogen: RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHBDF1 Blocking Peptide, (ABIN939696), is also available for use as a blocking control in assays to test for specificity of this RHBDF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHBDF1

Target: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Alternative Name: RHBDF1

Background: RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Growth Factor Binding