LPCAT1 antibody (Middle Region)

Catalog No. ABIN635206

This Rabbit Polyclonal antibody specifically detects LPCAT1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LPCAT1 antibody (Middle Region) (ABIN635206)

Target: LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LPCAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LPCAT1 Antibody

Binding Specificity: Middle Region

Specificity: LPCAT1 antibody was raised against the middle region of LPCAT1

Purification: Affinity purified

Immunogen: LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LPCAT1 Blocking Peptide, (ABIN5614555), is also available for use as a blocking control in assays to test for specificity of this LPCAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPCAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LPCAT1

Target: LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))

Alternative Name: LPCAT1

Background: Lysophosphatidylcholine (LPC) acyltransferase (LPCAT, EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.

Molecular Weight: 59 kDa (MW of target protein)