LRRC66 antibody (Middle Region)

Catalog No. ABIN635232

This anti-LRRC66 antibody is a Rabbit Polyclonal antibody detecting LRRC66 in WB. Suitable for Human.

Quick Overview for LRRC66 antibody (Middle Region) (ABIN635232)

Target: LRRC66 (Leucine Rich Repeat Containing 66 (LRRC66))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC66 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRC66 Antibody

Binding Specificity: Middle Region

Specificity: LRRC66 antibody was raised against the middle region of LRRC66

Purification: Affinity purified

Immunogen: LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC66 Blocking Peptide, (ABIN5614586), is also available for use as a blocking control in assays to test for specificity of this LRRC66 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC66 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC66

Target: LRRC66 (Leucine Rich Repeat Containing 66 (LRRC66))

Alternative Name: LRRC66

Background: The function of LOC339977 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 98 kDa (MW of target protein)