BACE2 antibody (N-Term)

Catalog No. ABIN635235

This anti-BACE2 antibody is a Rabbit Polyclonal antibody detecting BACE2 in WB. Suitable for Human.

Quick Overview for BACE2 antibody (N-Term) (ABIN635235)

Target: BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BACE2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BACE2 Antibody

Binding Specificity: N-Term

Specificity: BACE2 antibody was raised against the N terminal of BACE2

Purification: Affinity purified

Immunogen: BACE2 antibody was raised using the N terminal of BACE2 corresponding to a region with amino acids PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BACE2 Blocking Peptide, (ABIN5612267), is also available for use as a blocking control in assays to test for specificity of this BACE2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BACE2

Target: BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))

Alternative Name: BACE2

Background: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

Molecular Weight: 37 kDa (MW of target protein)