RNF182 antibody (Middle Region)

Catalog No. ABIN635241

This anti-RNF182 antibody is a Rabbit Polyclonal antibody detecting RNF182 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RNF182 antibody (Middle Region) (ABIN635241)

Target: RNF182 (Ring Finger Protein 182 (RNF182))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF182 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RNF182 Antibody

Binding Specificity: Middle Region

Specificity: RNF182 antibody was raised against the middle region of RNF182

Purification: Affinity purified

Immunogen: RNF182 antibody was raised using the middle region of RNF182 corresponding to a region with amino acids LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF182 Blocking Peptide, (ABIN5615900), is also available for use as a blocking control in assays to test for specificity of this RNF182 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF182 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF182

Target: RNF182 (Ring Finger Protein 182 (RNF182))

Alternative Name: RNF182

Background: RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.

Molecular Weight: 27 kDa (MW of target protein)