SLC41A3 antibody (C-Term)

Catalog No. ABIN635242

This Rabbit Polyclonal antibody specifically detects SLC41A3 in WB. It exhibits reactivity toward Human.

Quick Overview for SLC41A3 antibody (C-Term) (ABIN635242)

Target: SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC41A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC41A3 Antibody

Binding Specificity: C-Term

Specificity: SLC41 A3 antibody was raised against the C terminal of SLC41 3

Purification: Affinity purified

Immunogen: SLC41 A3 antibody was raised using the C terminal of SLC41 3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC41A3 Blocking Peptide, (ABIN5616254), is also available for use as a blocking control in assays to test for specificity of this SLC41A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC41A3

Target: SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))

Alternative Name: SLC41A3

Background: SLC41A3 is a multi-pass membrane protein. It belongs to the SLC41A transporter family. The exact function of SLC41A3 remains unknown.

Molecular Weight: 55 kDa (MW of target protein)