MOGAT1 antibody (C-Term)

Catalog No. ABIN635250

This anti-MOGAT1 antibody is a Rabbit Polyclonal antibody detecting MOGAT1 in WB. Suitable for Human and Mouse.

Quick Overview for MOGAT1 antibody (C-Term) (ABIN635250)

Target: MOGAT1 (Monoacylglycerol O-Acyltransferase 1 (MOGAT1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MOGAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MOGAT1 Antibody

Binding Specificity: C-Term

Specificity: MOGAT1 antibody was raised against the C terminal of MOGAT1

Purification: Affinity purified

Immunogen: MOGAT1 antibody was raised using the C terminal of MOGAT1 corresponding to a region with amino acids PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MOGAT1 Blocking Peptide, (ABIN5614811), is also available for use as a blocking control in assays to test for specificity of this MOGAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOGAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MOGAT1

Target: MOGAT1 (Monoacylglycerol O-Acyltransferase 1 (MOGAT1))

Alternative Name: MOGAT1

Background: Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.

Molecular Weight: 39 kDa (MW of target protein)