MUL1 antibody (Middle Region)
-
- Target See all MUL1 Antibodies
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MUL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 ORF166 antibody was raised against the middle region of C1 rf166
- Purification
- Affinity purified
- Immunogen
- C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG
- Top Product
- Discover our top product MUL1 Primary Antibody
-
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 45-95) antibody
MUL1 Reactivity: Human, Mouse, Rat WB, IF (p), FACS, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (Middle Region) antibodyMUL1 Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Cow WB Host: Rabbit Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 176-210) antibodyMUL1 Reactivity: Human WB Host: Rabbit Polyclonal RB49942 unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 272-301), (C-Term) antibodyMUL1 Reactivity: Human WB Host: Rabbit Polyclonal RB32336 unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 1-352) antibodyMUL1 Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 143-192) antibodyMUL1 Reactivity: Human, Mouse, Dog, Guinea Pig, Horse, Rabbit, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 216-265) antibodyMUL1 Reactivity: Human, Dog, Guinea Pig, Horse, Rabbit, Cow, Monkey, Bat WB Host: Rabbit Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 1-352) antibodyMUL1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1ORF166 Blocking Peptide, catalog no. 33R-4589, is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF166 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
- Alternative Name
- C1ORF166 (MUL1 Products)
- Background
- C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-
