MUL1 antibody (Middle Region)

Catalog No. ABIN635254

This Rabbit Polyclonal antibody specifically detects MUL1 in WB. It exhibits reactivity toward Human.

Quick Overview for MUL1 antibody (Middle Region) (ABIN635254)

Target: MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MUL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MUL1 Antibody

Binding Specificity: Middle Region

Specificity: C1 ORF166 antibody was raised against the middle region of C1 rf166

Purification: Affinity purified

Immunogen: C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF166 Blocking Peptide, (ABIN939975), is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF166 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MUL1

Target: MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))

Alternative Name: C1ORF166

Background: C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity