Dystroglycan antibody

Catalog No. ABIN635261

The Rabbit Polyclonal anti-Dystroglycan antibody is suitable to detect Dystroglycan in samples from Human. It has been validated for WB.

Quick Overview for Dystroglycan antibody (ABIN635261)

Target: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Dystroglycan antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Dystroglycan Antibody

Purification: Affinity purified

Immunogen: DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAG1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DAG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Dystroglycan

Target: Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))

Alternative Name: DAG1

Background: Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus