SGCE antibody (N-Term)

Catalog No. ABIN635274

This anti-SGCE antibody is a Rabbit Polyclonal antibody detecting SGCE in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SGCE antibody (N-Term) (ABIN635274)

Target: SGCE (Sarcoglycan, epsilon (SGCE))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SGCE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SGCE Antibody

Binding Specificity: N-Term

Specificity: SGCE antibody was raised against the N terminal of SGCE

Purification: Affinity purified

Immunogen: SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SGCE Blocking Peptide, (ABIN5616112), is also available for use as a blocking control in assays to test for specificity of this SGCE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SGCE

Target: SGCE (Sarcoglycan, epsilon (SGCE))

Alternative Name: SGCE

Background: SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix.

Molecular Weight: 52 kDa (MW of target protein)