SGCE antibody (N-Term)
-
- Target See all SGCE Antibodies
- SGCE (Sarcoglycan, epsilon (SGCE))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SGCE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SGCE antibody was raised against the N terminal of SGCE
- Purification
- Affinity purified
- Immunogen
- SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI
- Top Product
- Discover our top product SGCE Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SGCE Blocking Peptide, catalog no. 33R-9378, is also available for use as a blocking control in assays to test for specificity of this SGCE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SGCE (Sarcoglycan, epsilon (SGCE))
- Alternative Name
- SGCE (SGCE Products)
- Synonyms
- scge antibody, zgc:92318 antibody, DYT11 antibody, ESG antibody, e-SG antibody, sarcoglycan, epsilon antibody, sarcoglycan epsilon S homeolog antibody, sarcoglycan epsilon antibody, sgce antibody, sgce.S antibody, SGCE antibody, Sgce antibody
- Background
- SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix.
- Molecular Weight
- 52 kDa (MW of target protein)
-