IFNGR2 antibody

Catalog No. ABIN635275

This Rabbit Polyclonal antibody specifically detects IFNGR2 in WB. It exhibits reactivity toward Human.

Quick Overview for IFNGR2 antibody (ABIN635275)

Target: IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFNGR2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IFNGR2 Antibody

Purification: Affinity purified

Immunogen: IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFN Gamma R2 Blocking Peptide, (ABIN5614148), is also available for use as a blocking control in assays to test for specificity of this IFN Gamma R2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNGR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFNGR2

Target: IFNGR2 (Interferon gamma Receptor 2 (Interferon gamma Transducer 1) (IFNGR2))

Alternative Name: IFN gamma R2

Background: IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection.

Molecular Weight: 35 kDa (MW of target protein)