ERP29 antibody (N-Term)
-
- Target See all ERP29 Antibodies
- ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERP29 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ERP29 antibody was raised against the N terminal of ERP29
- Purification
- Affinity purified
- Immunogen
- ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI
- Top Product
- Discover our top product ERP29 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ERP29 Blocking Peptide, catalog no. 33R-5588, is also available for use as a blocking control in assays to test for specificity of this ERP29 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERP29 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))
- Alternative Name
- ERP29 (ERP29 Products)
- Background
- This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Molecular Weight
- 26 kDa (MW of target protein)
-