ERP29 antibody (N-Term)

Catalog No. ABIN635286

Product Details anti-ERP29 Antibody

Target: ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERP29 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ERP29 antibody was raised against the N terminal of ERP29

Purification: Affinity purified

Immunogen: ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERP29 Blocking Peptide, catalog no. 33R-5588, is also available for use as a blocking control in assays to test for specificity of this ERP29 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERP29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERP29

Target: ERP29 (Endoplasmic Reticulum Protein 29 (ERP29))

Alternative Name: ERP29 (ERP29 Products)

Synonyms: C12orf8 antibody, ERp28 antibody, ERp31 antibody, PDI-DB antibody, PDIA9 antibody, 1200015M03Rik antibody, 2810446M09Rik antibody, AW209030 antibody, Erp28 antibody, Erp31 antibody, PDI-Db antibody, endoplasmic reticulum protein 29 antibody, ERP29 antibody, Erp29 antibody

Background: This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.

Molecular Weight: 26 kDa (MW of target protein)