SLCO2B1 antibody (N-Term)

Catalog No. ABIN635293

This Rabbit Polyclonal antibody specifically detects SLCO2B1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SLCO2B1 antibody (N-Term) (ABIN635293)

Target: SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLCO2B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLCO2B1 Antibody

Binding Specificity: N-Term

Specificity: SLCO2 B1 antibody was raised against the N terminal of SLCO2 1

Purification: Affinity purified

Immunogen: SLCO2 B1 antibody was raised using the N terminal of SLCO2 1 corresponding to a region with amino acids DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLCO2B1 Blocking Peptide, (ABIN937497), is also available for use as a blocking control in assays to test for specificity of this SLCO2B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLCO2B1

Target: SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))

Alternative Name: SLCO2B1

Background: SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.

Molecular Weight: 77 kDa (MW of target protein)