SLC44A3 antibody (Middle Region)

Catalog No. ABIN635296

This Rabbit Polyclonal antibody specifically detects SLC44A3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SLC44A3 antibody (Middle Region) (ABIN635296)

Target: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC44A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC44A3 Antibody

Binding Specificity: Middle Region

Specificity: SLC44 A3 antibody was raised against the middle region of SLC44 3

Purification: Affinity purified

Immunogen: SLC44 A3 antibody was raised using the middle region of SLC44 3 corresponding to a region with amino acids TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC44A3 Blocking Peptide, (ABIN5616258), is also available for use as a blocking control in assays to test for specificity of this SLC44A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC44A3

Target: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Alternative Name: SLC44A3

Background: SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.

Molecular Weight: 68 kDa (MW of target protein)