ACBD5 antibody (C-Term)

Catalog No. ABIN635305

This Rabbit Polyclonal antibody specifically detects ACBD5 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ACBD5 antibody (C-Term) (ABIN635305)

Target: ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACBD5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACBD5 Antibody

Binding Specificity: C-Term

Specificity: ACBD5 antibody was raised against the C terminal of ACBD5

Purification: Affinity purified

Immunogen: ACBD5 antibody was raised using the C terminal of ACBD5 corresponding to a region with amino acids VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACBD5 Blocking Peptide, (ABIN5611889), is also available for use as a blocking control in assays to test for specificity of this ACBD5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACBD5

Target: ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))

Alternative Name: ACBD5

Background: ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.

Molecular Weight: 55 kDa (MW of target protein)