TMEM106C antibody (Middle Region)

Catalog No. ABIN635314

Product Details anti-TMEM106C Antibody

Target: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM106C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM106 C antibody was raised against the middle region of TMEM106

Purification: Affinity purified

Immunogen: TMEM106 C antibody was raised using the middle region of TMEM106 corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM106C Blocking Peptide, catalog no. 33R-6694, is also available for use as a blocking control in assays to test for specificity of this TMEM106C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM100 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM106C

Target: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Alternative Name: TMEM106C (TMEM106C Products)

Synonyms: MGC53571 antibody, tmem106C antibody, AI046681 antibody, BC046621 antibody, D15Ertd405e antibody, RGD1311532 antibody, transmembrane protein 106C L homeolog antibody, transmembrane protein 106C antibody, tmem106c.L antibody, TMEM106C antibody, tmem106c antibody, Tmem106c antibody

Background: TMEM106C belongs to the TMEM106 family. The exact function of TMEM106C remains unknown.

Molecular Weight: 28 kDa (MW of target protein)