TMEM106C antibody (Middle Region)

Catalog No. ABIN635314

This Rabbit Polyclonal antibody specifically detects TMEM106C in WB. It exhibits reactivity toward Human.

Quick Overview for TMEM106C antibody (Middle Region) (ABIN635314)

Target: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM106C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM106C Antibody

Binding Specificity: Middle Region

Specificity: TMEM106 C antibody was raised against the middle region of TMEM106

Purification: Affinity purified

Immunogen: TMEM106 C antibody was raised using the middle region of TMEM106 corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM106C Blocking Peptide, (ABIN5616653), is also available for use as a blocking control in assays to test for specificity of this TMEM106C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM100 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM106C

Target: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Alternative Name: TMEM106C

Background: TMEM106C belongs to the TMEM106 family. The exact function of TMEM106C remains unknown.

Molecular Weight: 28 kDa (MW of target protein)