SLC27A3 antibody

Catalog No. ABIN635324

Product Details anti-SLC27A3 Antibody

Target: SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC27A3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC27 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC27A3 Blocking Peptide, catalog no. 33R-7087, is also available for use as a blocking control in assays to test for specificity of this SLC27A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC27A3

Target: SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))

Alternative Name: SLC27A3 (FATP3 Products)

Synonyms: ACSVL3 antibody, FATP3 antibody, VLCS-3 antibody, Acsvl3 antibody, Vlcs-3 antibody, solute carrier family 27 member 3 antibody, solute carrier family 27 (fatty acid transporter), member 3 antibody, Slc27a3 antibody, SLC27A3 antibody

Background: SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.

Molecular Weight: 79 kDa (MW of target protein)