SLC27A3 antibody
-
- Target See all SLC27A3 (FATP3) Antibodies
- SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC27A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC27 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP
- Top Product
- Discover our top product FATP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC27A3 Blocking Peptide, catalog no. 33R-7087, is also available for use as a blocking control in assays to test for specificity of this SLC27A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))
- Alternative Name
- SLC27A3 (FATP3 Products)
- Synonyms
- ACSVL3 antibody, FATP3 antibody, VLCS-3 antibody, Acsvl3 antibody, Vlcs-3 antibody, solute carrier family 27 member 3 antibody, solute carrier family 27 (fatty acid transporter), member 3 antibody, Slc27a3 antibody, SLC27A3 antibody
- Background
- SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.
- Molecular Weight
- 79 kDa (MW of target protein)
-