SLC27A3 antibody

Catalog No. ABIN635324

The Rabbit Polyclonal anti-SLC27A3 antibody is suitable to detect SLC27A3 in samples from Human. It has been validated for WB.

Quick Overview for SLC27A3 antibody (ABIN635324)

Target: SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC27A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC27A3 Antibody

Purification: Affinity purified

Immunogen: SLC27 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC27A3 Blocking Peptide, (ABIN5616233), is also available for use as a blocking control in assays to test for specificity of this SLC27A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC27A3

Target: SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))

Alternative Name: SLC27A3

Background: SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.

Molecular Weight: 79 kDa (MW of target protein)