Lamin B Receptor antibody (Middle Region)

Catalog No. ABIN635330

The Rabbit Polyclonal anti-Lamin B Receptor antibody has been validated for WB. It is suitable to detect Lamin B Receptor in samples from Human.

Quick Overview for Lamin B Receptor antibody (Middle Region) (ABIN635330)

Target: Lamin B Receptor (LBR)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lamin B Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Lamin B Receptor Antibody

Binding Specificity: Middle Region

Specificity: Lamin B Receptor antibody was raised against the middle region of LBR

Purification: Affinity purified

Immunogen: Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lamin B Receptor Blocking Peptide, (ABIN938550), is also available for use as a blocking control in assays to test for specificity of this Lamin B Receptor antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lamin B Receptor

Target: Lamin B Receptor (LBR)

Alternative Name: Lamin B Receptor

Background: The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Molecular Weight: 71 kDa (MW of target protein)