TM4SF20 antibody (Middle Region)

Catalog No. ABIN635333

The Rabbit Polyclonal anti-TM4SF20 antibody has been validated for WB. It is suitable to detect TM4SF20 in samples from Human.

Quick Overview for TM4SF20 antibody (Middle Region) (ABIN635333)

Target: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TM4SF20 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TM4SF20 Antibody

Binding Specificity: Middle Region

Specificity: TM4 SF20 antibody was raised against the middle region of TM4 F20

Purification: Affinity purified

Immunogen: TM4 SF20 antibody was raised using the middle region of TM4 F20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TM4SF20 Blocking Peptide, (ABIN5616644), is also available for use as a blocking control in assays to test for specificity of this TM4SF20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TM4SF20

Target: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Alternative Name: TM4SF20

Background: TM4SF20 functions as a cellular component of the plasma membrane.

Molecular Weight: 25 kDa (MW of target protein)